Thionin

Thionins are small, basic plant proteins, 45 to 50 amino acids in length, which include three or four conserved disulphide linkages. The proteins are toxic to animal cells, presumably attacking the cell membrane and rendering it permeable: this results in the inhibition of sugar uptake and allows potassium and phosphate ions, proteins, and nucleotides to leak from cells [PMID: 3985614]. Thionins are mainly found in seeds where they may act as a defence against consumption by animals. A barley (Hordeum vulgare) leaf thionin that is highly toxic to plant pathogens and is involved in the mechanism of plant defence against microbial infections has also been identified [PMID: 1377959]. The hydrophobic protein crambin from the Abyssinian kale (Crambe abyssinica) is also a member of the thionin family [PMID: 3985614].

The below sequences were used to create Thionin sequence signatures:

>CAMPSQ3709
KSCCRSTLGRNCYNLCRARGAQKLCAGVCRCKISSGLSCPKGFPK
>CAMPSQ3710
KSCCKSTLGRNCYNLCRARGAQKLCANVCRCKLTSGLSCPKDFPK
>CAMPSQ3710
KSCCPSTTARNIYNTCRLTGASRSVCASLSGCKIISGSTCDSGWNH
>CAMPSQ137
KSCCRNTWARNCYNVCRLPGTISREICAKKCDCKIISGTTCPSDYPK
>CAMPSQ946
KSCCKDTLARNCYNTCRFAGGSRPVCAGACRCKIISGPKCPSDYPK

The below sequences were retrieved using Thionin sequence signatures:

> CAMPThiP, CAMPThiH | CAMPSQ137 | P07504 | 135798
KSCCRNTWARNCYNVCRLPGTISREICAKKCDCKIISGTTCPSDYPK
> CAMPThiP, CAMPThiH | CAMPSQ946 | P09618 | 2507457
KSCCKDTLARNCYNTCRFAGGSRPVCAGACRCKIISGPKCPSDYPK
2015, © Biomedical Informatics Centre, NIRRH, Mumbai