CAMPSQ1033
Title : Raphanus Sativus Antifungal Protein 1
GenInfo Identifier : 59798992
Source : Raphanus sativus var. niger [Chinese radish]
Taxonomy : Viridiplantae
NCBI Taxonomy : 3726
UniProt: P69241
PDB: 1AYJ
Structure Database : CAMPST386
PubMed : 7780308, 1639777
Length : 51
Activity : Antifungal
Target : [PubMed ID : 7780308 - A. brassicola ( MIC = 15 microg/ml), Botrytis cinerea ( MIC = 8 microg/ml), F. culmorum ( MIC = 5 microg/ml)] [PubMed ID: 1639777 - Alternaria brassicola ( IC50 = 15 ?g/ml) , Ascochyta pisi ( IC50 = 5 ?g/ml) , Botrytis cinerea ( IC50 = 8 ?g/ml) , Cercospora beticola ( IC50 = 2 ?g/ml) , Colletotrichum lindemuthianum ( IC50 = 100 ?g/ml) , Fusarium culmorum ( IC50 = 5 ?g/ml) , Fusarium oxysporum f.sp. lycopersici ( IC50 = 30 ?g/ml) , Fusarium oxysporum f.sp. pisi ( IC50 = 15 ?g/ml) , Mycosphaerella fijiensis var. fijiensis ( IC50 = 4 ?g/ml), Nectria haematococca ( IC50 = 6 ?g/ml), Phoma betae ( IC50 = 2 ?g/ml) , Phytophthora infestans ( IC50 = 3 ?g/ml) , Pyrenophora tritici-repentis ( IC50 = 3 ?g/ml) , Pyricularia oryzae ( IC50 = 0.3 ?g/ml) , Rhizoctonia solani ( IC50 = 100 ?g/ml) , Sclerotinia sclerotiorum ( IC50 = 20 ?g/ml) , Septoria nodorum ( IC50 = 20 ?g/ml) , Trichoderma hamatum ( IC50 = 6 ?g/ml) , Verticillium dahliae ( IC50 = 5 ?g/ml)
Validated : Experimentally Validated
Pfam : PF00304 : ( Gamma-thionin family )
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC