| CAMPSQ1268 |
| Title : |
CECA1_DROSI Cecropin-A1 precursor |
| GenInfo Identifier : |
25089850 |
| Source : |
Drosophila simulans [Fruit fly] |
| Taxonomy : |
Animalia, Insects |
| UniProt: |
O61272 |
| PubMed : |
9725836 |
| Length : |
43 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram+ve, Gram-ve |
| Validated : |
Predicted |
| Pfam : |
PF00272 : ( Cecropin family )
|
| InterPro : |
IPR000875 : Cecropin.
IPR020400 : Cecropin_diptera.
|
| AMP Family : |
Cecropin |
| Signature : |
| ID |
Type |
Pattern / HMM |
T. Length |
|
CAMPCecH |
HMM |
 |
Variable |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
ISS |
| GO:0050829 |
Biological Process |
Defense response to Gram-negative bacterium |
ISS |
| GO:0050830 |
Biological Process |
Defense response to Gram-positive bacterium |
ISS |
| GO:0045087 |
Biological Process |
Innate immune response |
IEA |
|
Sequence: |
QSEAGWLKKIGKKIERVGQHTRDATIQGLGVAQQAPNVAATAR |