| CAMPSQ1433 |
| Title : |
Hepcidin 2 |
| GenInfo Identifier : |
51854820 |
| Source : |
Pagrus major [Red sea bream] |
| Taxonomy : |
Animalia, Pisces |
| UniProt: |
Q66NI7 |
| Length : |
85 |
| Activity : |
Antimicrobial |
| Validated : |
Predicted |
| Pfam : |
PF06446 : ( Hepcidin )
|
| InterPro : |
IPR010500 : Hepcidin.
|
| AMP Family : |
Hepcidin |
| Signature : |
| ID |
Type |
Pattern / HMM |
T. Length |
|
CAMPHepH |
HMM |
 |
Variable |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IEA |
| GO:0006879 |
Biological Process |
Cellular iron ion homeostasis |
IEA |
|
Sequence: |
MKTFSVAVAVAVVLTFICLQESSAVSFTEVQELEEPMSNGSPVAAYEEMSEESWKMPYAS RRWRCRFCCRCCPRMRGCGLCCQRR |