CAMPSQ1483
Title : Heliomicin Mutant
GenInfo Identifier : 159162452
Source : Heliothis virescens [Tobacco budworm moth]
Taxonomy : Animalia, Insects
UniProt: P81544
PDB: 1I2U, 1I2V
Structure Database : CAMPST339, CAMPST29
PubMed : 11580275
Length : 44
Activity : Antibacterial, Antifungal
Validated : Predicted
Pfam : PF00537 : ( Scorpion toxin-like domain )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
IPR002061 : Scorpion_toxinL/defesin.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0008200 Molecular Function Ion channel inhibitor activity IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0045087 Biological Process Innate immune response IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
 DKLIGSCVWGAVNYTSDCNGECLLRGYKGGHCGSFANVNCWCET