| CAMPSQ1717 |
| Title : |
Antibacterial protein LL-37 |
| GenInfo Identifier : |
115503699 |
| Source : |
Callithrix jacchus [White-tufted-ear marmoset] |
| Taxonomy : |
Animalia, Mammals |
| UniProt: |
Q1KLY4 |
| Length : |
37 |
| Activity : |
Antibacterial |
| Validated : |
Predicted |
| Pfam : |
PF12153 : ( LPS binding domain of CAP18 (C terminal) )
PF00666 : ( Cathelicidin )
|
| InterPro : |
IPR001894 : Cathelicidin.
IPR018216 : Cathelicidin_CS.
IPR022746 : Cathlecidin_C.
|
| AMP Family : |
Cathelicidin |
| Signature : |
| ID |
Type |
Pattern / HMM |
T. Length |
|
CAMPCatH |
HMM |
 |
Variable |
|
CAMPCatH37 |
HMM |
 |
37 |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IEA |
| GO:0042742 |
Biological Process |
Defense response to bacterium |
IEA |
|
Sequence: |
RLGDILQKAREKIEGGLKKLVQKIKDFFGKFAPRTES |