| CAMPSQ1968 |
| Title : |
Penaeidin-3i |
| GenInfo Identifier : |
25090985 |
| Source : |
Litopenaeus vannamei [Whiteleg shrimp] |
| Taxonomy : |
Animalia, Crustaceans (Malacostraca) |
| UniProt: |
Q963C5 |
| Length : |
62 |
| Activity : |
Antibacterial, Antifungal |
| Validated : |
Predicted |
| Pfam : |
PF05927 : ( Penaeidin )
|
| InterPro : |
IPR009226 : Penaeidin.
|
| AMP Family : |
Penaeidin |
| Signature : |
| ID |
Type |
Pattern / HMM |
T. Length |
|
CAMPPenP |
Pattern |
G-[HY]-T-x-P-x(1,3)-P-x(0,1)-R-P-[ILP]-x(4)-[IP]-[GILP]-x(3)-[CPV]-x-[CGNT] |
Variable |
|
CAMPPenH |
HMM |
 |
Variable |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005737 |
Cellular Component |
Cytoplasm |
IEA |
| GO:0008061 |
Molecular Function |
Chitin binding |
IEA |
| GO:0042742 |
Biological Process |
Defense response to bacterium |
IEA |
| GO:0050832 |
Biological Process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological Process |
Killing of cells of other organism |
IEA |
|
Sequence: |
QVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGRPVSCRGISFSQARSCCSRLGRCCHVGKG YS |