| CAMPSQ204 |
| Title : |
Cyclopsychotride-A |
| GenInfo Identifier : |
17433720 |
| Source : |
Psychotria longipes |
| Taxonomy : |
Viridiplantae |
| UniProt: |
P56872 |
| PubMed : |
10430870 |
| Length : |
31 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram+ve, Gram-ve |
| Target : |
E. coli ( MIC =1.55 microM), P.aeruginosa ( MIC =13.5 microM), Pr.vulgaris ( MIC =13.2 microM), K. oxytoca ( MIC =5.80 microM), S. aureus ( MIC =39.0 microM), M. luteus ( MIC =48.0 microM), C. albicans ( MIC =>500 microM), C. kefyr ( MIC =14.0 microM), C. tropicalis ( MIC =56.5 microM) |
| Validated : |
Experimentally Validated |
| Pfam : |
PF03784 : ( Cyclotide family )
|
| InterPro : |
IPR005535 : Cyclotide.
IPR012323 : Cyclotide_bracelet_CS.
IPR017307 : Cyclotide_subgr.
|
| AMP Family : |
Cyclotide |
| Signature : |
| ID |
Type |
Pattern / HMM |
T. Length |
|
CAMPCycH |
HMM |
 |
Variable |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0042742 |
Biological Process |
Defense response to bacterium |
IEA |
|
Sequence: |
SIPCGESCVFIPCTVTALLGCSCKSKVCYKN |