| CAMPSQ2193 |
| Title : |
Brevinin-2RTb antimicrobial peptide |
| GenInfo Identifier : |
269858976 |
| Source : |
Amolops ricketti [Chinese sucker frog] |
| Taxonomy : |
Animalia, Amphibians |
| UniProt: |
D1MIZ8 |
| Length : |
74 |
| Activity : |
Antimicrobial |
| Validated : |
Predicted |
| Pfam : |
PF08023 : ( Frog antimicrobial peptide )
PF03032 : ( Brevenin/esculentin/gaegurin/rugosin family )
|
| InterPro : |
IPR012521 : Antimicrobial_frog_2.
IPR004275 : Brevinin.
|
| AMP Family : |
Brevinin |
| Signature : |
| ID |
Type |
Pattern / HMM |
T. Length |
|
CAMPBreH |
HMM |
 |
Variable |
|
CAMPRanH28 |
HMM |
 |
28 |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IEA |
| GO:0042742 |
Biological Process |
Defense response to bacterium |
IEA |
|
Sequence: |
MFTSKKSLLVLFFLGTISLSFCEEERNADEDDGEMTEEVKRGILDTLKEFGKTAAKGIAQ SLLSTASCKLAKTC |