| CAMPSQ2227 |
| Title : |
Lactoferrin |
| GenInfo Identifier : |
255648506 |
| Source : |
Bubalus bubalis [Domestic water buffalo] |
| Taxonomy : |
Animalia, Mammals |
| UniProt: |
C7DZZ8 |
| Length : |
69 |
| Activity : |
Antimicrobial |
| Validated : |
Predicted |
| Pfam : |
PF00405 : ( Transferrin )
|
| InterPro : |
IPR001156 : Transferrin_fam.
|
| AMP Family : |
Transferrin |
| Signature : |
| ID |
Type |
Pattern / HMM |
T. Length |
|
CAMPTraP |
Pattern |
W-Q-x(0,1)-R-x(0,1)-M-[KR]-K-[LV] |
Variable |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IEA |
| GO:0008199 |
Molecular Function |
Ferric iron binding |
IEA |
| GO:0006879 |
Biological Process |
Cellular iron ion homeostasis |
IEA |
| GO:0006826 |
Biological Process |
Iron ion transport |
IEA |
|
Sequence: |
WQWRMKKLGAPCISCLRRAFALESIRAIPEKKADAVTLDDAMVFEAGRGCLRLRPVAAEM YGTKECIQS |