CAMPSQ236
Title : Defense-related peptide 1
GenInfo Identifier : 20139322
Source : Pisum sativum [Garden pea]
Taxonomy : Viridiplantae
UniProt: P81929
PDB: 1JKZ, 2IIW, 2IJ1, 2IJT, 2IJU, 2IJV, 2IJW, 2IKL, 2IKM, 2IKN, 2IKP, 2IKR, 2IKT, 2IKV, 2IKW, 2IKX, 2IKY, 2IKZ, 2IL0, 2ILC, 2ILD, 2ILE, 2ILF, 2ILG, 2ILH, 2ILJ
PubMed : 10860545
Length : 46
Activity : Antifungal
Target : Aspergillus niger ( MIC = 12.1 microg/ml), Aspergillus versicolor ( MIC = <5.0 microg/ml), Fusarium moniliforme ( MIC = 21.7 microg/ml), Fusarium oxysporum ( MIC = >100 microg/ml), Fusarium solani ( MIC = 12.1 microg/ml), Neurospora crassa ( MIC = 0.04 microg/ml), Saccharomyces cerevisae ( MIC = >100 microg/ml), Trichophyton mentagrophytes ( MIC = >100 microg/ml)
Validated : Experimentally Validated
Pfam : PF00304 : ( Gamma-thionin family )
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNC