CAMPSQ236 |
Title : |
Defense-related peptide 1 |
GenInfo Identifier : |
20139322 |
Source : |
Pisum sativum [Garden pea] |
Taxonomy : |
Viridiplantae |
UniProt: |
P81929 |
PDB: |
1JKZ, 2IIW, 2IJ1, 2IJT, 2IJU, 2IJV, 2IJW, 2IKL, 2IKM, 2IKN, 2IKP, 2IKR, 2IKT, 2IKV, 2IKW, 2IKX, 2IKY, 2IKZ, 2IL0, 2ILC, 2ILD, 2ILE, 2ILF, 2ILG, 2ILH, 2ILJ |
PubMed : |
10860545 |
Length : |
46 |
Activity : |
Antifungal |
Target : |
Aspergillus niger ( MIC = 12.1 microg/ml), Aspergillus versicolor ( MIC = <5.0 microg/ml), Fusarium moniliforme ( MIC = 21.7 microg/ml), Fusarium oxysporum ( MIC = >100 microg/ml), Fusarium solani ( MIC = 12.1 microg/ml), Neurospora crassa ( MIC = 0.04 microg/ml), Saccharomyces cerevisae ( MIC = >100 microg/ml), Trichophyton mentagrophytes ( MIC = >100 microg/ml) |
Validated : |
Experimentally Validated |
Pfam : |
PF00304 : ( Gamma-thionin family )
|
InterPro : |
IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
|
AMP Family : |
Defensin |
Gene Ontology : |
GO ID |
Ontology |
Definition |
Evidence |
GO:0050832 |
Biological Process |
Defense response to fungus |
IEA |
GO:0031640 |
Biological Process |
Killing of cells of other organism |
IEA |
|
Sequence: |
KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNC |