CAMPSQ345
Title : Neutrophil defensin 3, Defensin-6
GenInfo Identifier : 30316323, 4503305
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
NCBI Taxonomy : 9606
UniProt: P59666, Q6EZF9
PDB: 1DFN, 1ZMH, 1ZMI, 1ZMK, 2PM4, 2PM5
Structure Database : CAMPST494, CAMPST92, CAMPST93, CAMPST94, CAMPST236, CAMPST237
PubMed : 2006422
Length : 30
Activity : Antibacterial, Antifungal, Antiviral
Target : Enveloped viruses
Validated : Experimentally Validated
Pfam : PF00323 : ( Mammalian defensin )
PF00879 : ( Defensin propeptide )
InterPro : IPR016327 : Alpha-defensin.
IPR006080 : Defensin_beta/neutrophil.
IPR002366 : Defensin_propep.
IPR006081 : Mammalian_defensins.
AMP Family : Defensin
Signature :
ID Type Pattern / HMM T. Length
CAMPDefP30 Pattern C-x(4)-C-x(4)-R-[QR]-x-G-T-C-[FIL] 30
CAMPDefH30 HMM 30
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0035578 Cellular Component Azurophil granule lumen TAS
GO:0005576 Cellular Component Extracellular region TAS
GO:0005615 Cellular Component Extracellular space IEA
GO:0005796 Cellular Component Golgi lumen TAS
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0051607 Biological Process Defense response to virus IEA
GO:0045087 Biological Process Innate immune response TAS
GO:0031640 Biological Process Killing of cells of other organism IEA
GO:0005615 Cellular Component Extracellular space IEA
GO:0042742 Biological Process Defense response to bacterium IEA
Sequence:
 DCYCRIPACIAGERRYGTCIYQGRLWAFCC