CAMPSQ4262
Title : Myticin C
GenInfo Identifier : 374858661
Source : Mytilus galloprovincialis [Mediterranean mussel]
Taxonomy : Animalia, Molluscs (Bivalvia)
NCBI Taxonomy : 29158
UniProt: H6BJS2
PubMed : 21904604
Length : 100
Activity : Antimicrobial
Validated : Predicted
Pfam : PF10690 : ( Myticin pre-proprotein from the mussel )
InterPro : IPR019631 : Myticin_preproprotein.
AMP Family : Myticin
Signature :
ID Type Pattern / HMM T. Length
CAMPMytH HMM Variable
Sequence:
MKATILLAVVVVVIVGVQEAQSIPCTSYYCSKFCGSAGCSLYGCYKLHPGKICYRLHCRR
AESPLALSGSARNVNEQNKEMVNSPVMNEVENLDQEMDMF