CAMPSQ4289
Title : Hepcidin
GenInfo Identifier : 282167192
Source : Crocodylus siamensis [Siamese crocodile]
Taxonomy : Animalia
UniProt: E8ZAD0
PubMed : 22967859
Length : 99
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target : The inhibition ratio of the hepcidin expression in the supernatant to S. aureus, B. subtilis, E. coli and A. sobria was 69.2 +/- 0.5%, 85.7 +/- 0.6%, 76.0 +/- 0.7% and 51.7 +/- 3.3%, respectively.
Validated : Experimentally Validated
Pfam : PF06446 : ( Hepcidin )
InterPro : IPR010500 : Hepcidin.
AMP Family : Hepcidin
Signature :
ID Type Pattern / HMM T. Length
CAMPHepH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0006879 Biological Process Cellular iron ion homeostasis IEA
Sequence:
MKVLAACVFLLLLVLLHGSPAACSALRAQANIGLMPRPETGAQSHGLEAAAGLMPHPEIG
AQSLEVPLRRSKRFNSHFPICSYCCNCCRNKGCGLCCRT