CAMPSQ68
Title : Drosomycin
GenInfo Identifier : 1169363
Source : Drosophila melanogaster [Fruit fly]
Taxonomy : Animalia, Insects
UniProt: P41964
PDB: 1MYN
PubMed : 7806546
Length : 44
Activity : Antifungal
Target : N. crassa ( IC50 = 0.6 microM), B. cinerea ( IC50 = 1.2 microM), F. culmorum ( IC50 = 1.0 microM ), A. brassicola ( IC50 = 0.9 microM), A. longipes (IC 50 1.4 microM), N . haematococca ( IC50 = 1.8 microM), F. oxysporum( IC50 = 4.2 microM), A. pisi ( IC50 = 3.2 microM)
Validated : Experimentally Validated
Pfam : PF00304 : ( Gamma-thionin family )
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IDA
GO:0019731 Biological Process Antibacterial humoral response TAS
GO:0019732 Biological Process Antifungal humoral response IEP
GO:0051715 Biological Process Cytolysis in other organism IDA
GO:0050829 Biological Process Defense response to Gram-negative bacterium TAS
GO:0042832 Biological Process Defense response to protozoan IDA
GO:0045087 Biological Process Innate immune response NAS
Sequence:
DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC