CAMPSQ692
Title : Human defensin 1
GenInfo Identifier : 4758146
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: P59665
PDB: 2KHT, 2PM1, 3GNY, 3H6C, 3HJ2, 3HJD, 3LO1, 3LO2, 3LO4, 3LO6, 3LO9, 3LOE, 3LVX, 4DU0
Structure Database : CAMPST178, CAMPST235, CAMPST261, CAMPST264, CAMPST265, CAMPST266, CAMPST274, CAMPST275, CAMPST276, CAMPST277, CAMPST278, CAMPST279, CAMPST280, CAMPST314
PubMed : 17635867
Length : 30
Activity : Antibacterial
Target : T. cruzi
Validated : Experimentally Validated
Pfam : PF00323 : ( Mammalian defensin )
PF00879 : ( Defensin propeptide )
InterPro : IPR016327 : Alpha-defensin.
IPR006080 : Defensin_beta/neutrophil.
IPR002366 : Defensin_propep.
IPR006081 : Mammalian_defensins.
AMP Family : Defensin
Signature :
ID Type Pattern / HMM T. Length
CAMPDefP30 Pattern C-x(4)-C-x(4)-R-[QR]-x-G-T-C-[FIL] 30
CAMPDefH32 HMM 32
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0035578 Cellular Component Azurophil granule lumen TAS
GO:0005576 Cellular Component Extracellular region TAS
GO:0005615 Cellular Component Extracellular space IEA
GO:0005796 Cellular Component Golgi lumen TAS
GO:0006935 Biological Process Chemotaxis TAS
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0051607 Biological Process Defense response to virus IEA
GO:0045087 Biological Process Innate immune response TAS
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
ACYCRIPACIAGERRYGTCIYQGRLWAFCC