CAMPSQ693
Title : Beta defensin 1
GenInfo Identifier : 37547390
Source : Chinchilla lanigera [Long-tailed chinchilla]
Taxonomy : Animalia, Mammals
NCBI Taxonomy : 34839
UniProt: P83943
PubMed : 14996845
Length : 36
Activity : Antibacterial, Antifungal
Target : S.pneumoniae ( MIC = 5 microg/ml), M.catarrhalis ( MIC = 5 microg/ml), C.ablicans ( MIC = 12.5-20 microg/ml)
Validated : Experimentally Validated
Pfam : PF00711 : ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
QRYFCRVRGGRCAALTCLPRETQIGRCSVKGRKCCR