CAMPSQ855
Title : Myticin-B
GenInfo Identifier : 6647598
Source : Mytilus galloprovincialis [Mediterranean mussel]
Taxonomy : Animalia, Molluscs (Bivalvia)
UniProt: P82102
PubMed : 10491159
Length : 40
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve, Gram-ve
Target : Micrococcus luteus ( MIC = 1-2 microM) , Bacillus megaterium ( MIC = 1-2 microM) , Staphylococcus aureus ( MIC = >20 microM) , Listeria monocytogenes ( MIC = >20 microM) , Enterococcus viridans ( MIC = 2-4 microM) , Escherichia coli D31 ( MIC = 120 -210 microM) , Salmonella newport ( MIC = 120 -210 microM) , Salmonella typhimurium ( MIC => 20 microM) , Brucella suis ( MIC => 20 microM) , Pseudomonas aeruginosa ( MIC => 20 microM) , Vibrio alginolyticus ( MIC => 20 microM) , Vibrio vulnificus ( MIC => 20 microM) , Vibrio splendidus ( MIC => 20 microM) , Fusarium oxysporum ( MIC = 5-10 microM) , Perkinsus marinus ( MIC => 20 microM)
Validated : Experimentally Validated
Pfam : PF10690 : ( Myticin pre-proprotein from the mussel )
InterPro : IPR019631 : Myticin_preproprotein.
AMP Family : Myticin
Signature :
ID Type Pattern / HMM T. Length
CAMPMytP Pattern C-T-S-Y-[WY]-C-[GS]-K-F-C-G-[ST]-A-[GS]-C-[ST]-x-Y-[GL]-C-x(2)-L-H-x-G-K-[ILM]-C-x-C-[LV]-H-C-S-R Variable
CAMPMytH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
HPHVCTSYYCSKFCGTAGCTRYGCRNLHRGKLCFCLHCSR