CAMPSQ885 |
Title : |
Spheniscin-2 |
GenInfo Identifier : |
41019461 |
Source : |
Aptenodytes patagonicus [King penguin] |
Taxonomy : |
Animalia, Aves |
UniProt: |
P83430 |
PDB: |
1UT3 |
PubMed : |
14525994 , 15123713 |
Length : |
38 |
Activity : |
Antibacterial, Antifungal |
Gram Nature : |
Gram+ve, Gram-ve |
Target : |
M. luteus ( MIC = 1.5-3.0 microM) , B. subtilis ( MIC = 0.8-1.5 microM) , B. cereus ATCC 11778 ( MIC = 3-6 microM) , B. megaterium ( MIC = 0.4-0.8 microM) , S. aureus ( MIC = 1.5-3.0 microM) , S. saprophyticus ( MIC = 1.5-3.0 microM) , S. haemolyticus ( MIC = 1.5-3.0 microM) , N. asteroides ( MIC = 0.8-1.5 microM) , A. viridans ( MIC = 0.4-0.8 microM) , L. monocytogenes ( MIC = 6-12 microM) , E. coli SBS 363 ( MIC = 0.8-1.5 microM) , E. coli 1106 ( MIC = 1.5-3.0 microM) , S. typhimurium ( MIC = 6-12 microM) , K. pneumoniae ( MIC = 50-100 microM) , P. aeruginosa ATCC 82118 ( MIC = 6-12 microM) , V. metshnikovii NCTC 8483 ( MIC = 25-50 microM) , V. anguillarum ATCC 19264 ( MIC = 25-50 microM) , C. glabrata ( MIC > 100 microM) , C. albicans IHEM 8060 ( MIC = 50-100 microM) , C. tropicalis ( MIC = 1.5-3.0 microM) , N. crassa ( MIC = 3-6 microM) , A. fumigatus ( MIC = 3-6 microM) |
Validated : |
Experimentally Validated |
Comment : |
Inactive against E. cloacae , A. faecalis |
Pfam : |
PF00711 : ( Beta defensin )
|
InterPro : |
IPR001855 : Defensin_beta-typ.
|
AMP Family : |
Defensin |
Gene Ontology : |
GO ID |
Ontology |
Definition |
Evidence |
GO:0005576 |
Cellular Component |
Extracellular region |
IEA |
GO:0042742 |
Biological Process |
Defense response to bacterium |
IEA |
GO:0050832 |
Biological Process |
Defense response to fungus |
IEA |
GO:0031640 |
Biological Process |
Killing of cells of other organism |
IEA |
|
Sequence: |
SFGLCRLRRGFCARGRCRFPSIPIGRCSRFVQCCRRVW |