CAMPSQ900
Title : Holotricin-2
GenInfo Identifier : 2493578
Source : Holotrichia diomphalia [Korean black chafer]
Taxonomy : Animalia, Insects
NCBI Taxonomy : 33394
UniProt: Q25054
PubMed : 8188641
Length : 72
Activity : Antibacterial
Gram Nature : Gram-ve
Validated : Experimentally Validated
Pfam : PF06286 : ( Coleoptericin )
InterPro : IPR009382 : Coleoptericin.
AMP Family : Coleoptericin
Signature :
ID Type Pattern / HMM T. Length
CAMPColP Pattern G-x(0,1)-N-T-x-[AGT]-[DQT]-I-[DEN]-[AIV]-Q-x-[HK]-[GT]-[DEK]-[DNR]-x-D-[FV]-x-[AG]-[GT]-W-[GST]-K-V-[IV]-[DR]-G-P-[GN]-[KR]-[AS]-K-P-[NT]-[FW]-x-[IV]-G-G-[ST]-[HY]-R Variable
CAMPColH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0045087 Biological Process Innate immune response IEA
Sequence:
SLQPGAPSFPMPGSQLPTSVSGNVEKQGRNTIATIDAQHKTDRYDVRGTWTKVVDGPGRS
KPNFRIGGSYRW