CAMPSQ912
Title : Cysteine-rich antifungal protein 1 (At-AFP1)
GenInfo Identifier : 3915600
Source : Arabidopsis thaliana [Mouse-ear cress]
Taxonomy : Viridiplantae
NCBI Taxonomy : 3702
UniProt: P30224
PubMed : 8422949
Length : 51
Activity : Antifungal
Target : Alternaria brassicola ( IC50 = 10 microg/ml) , Botrytis cinerea ( IC50 = 3.90 microg/ml) , Fusarium culmorum ( IC50 = 3 microg/ml) , Fusarium oxysporum f.sp.lycopersici ( IC50 = 3 microg/ml) , Pyricularia oryzae ( IC50 = 0.25 microg/ml) , Verticiliium dahliae ( IC50 = 1.50 microg/ml)
Validated : Experimentally Validated
Pfam : PF00304 : ( Gamma-thionin family )
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0006952 Biological Process Defense response ISS
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
QKLCERPSGTWSGVCGNSNACKNQCINLEKARHGSCNYVFPAHKCICYFPC