CAMPSQ913
Title : Antifungal protein AX1
GenInfo Identifier : 6225076
Source : Beta vulgaris [Sugar beet]
Taxonomy : Viridiplantae
NCBI Taxonomy : 161934
UniProt: P81493
PubMed : 7655063
Length : 46
Activity : Antifungal
Target : C. beticola , other filamentous fungii
Validated : Experimentally Validated
Comment : Inactive against bacteria
Pfam : PF00304 : ( Gamma-thionin family )
InterPro : IPR008177 : G_Purothionin.
IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
 AICKKPSKFFKGACGRDADCEKACDQENWPGGVCVPFLRCECQRSC