| CAMPSQ922 |
| Title : |
Cysteine-rich antifungal protein 2 |
| GenInfo Identifier : |
1703206 |
| Source : |
Raphanus sativus [Radish] |
| Taxonomy : |
Viridiplantae |
| NCBI Taxonomy : |
3726 |
| UniProt: |
P30230 |
| PubMed : |
7780308 |
| Length : |
51 |
| Activity : |
Antifungal |
| Target : |
A. brassicola ( MIC = 2 microg/ml) , Botrytis cinerea ( MIC = 2 microg/ml) , F. culmorum ( MIC = 2 microg/ml) |
| Validated : |
Experimentally Validated |
| Pfam : |
PF00304 : ( Gamma-thionin family )
|
| InterPro : |
IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IEA |
| GO:0050832 |
Biological Process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological Process |
Killing of cells of other organism |
IEA |
|
Sequence: |
QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC |
