CAMPSQ923
Title : Scarabaecin
GenInfo Identifier : 74813990
Source : Oryctes rhinoceros [Coconut rhinoceros beetle]
Taxonomy : Animalia, Insects
NCBI Taxonomy : 72550
UniProt: Q86SC0
PDB: 1IYC
Structure Database : CAMPST30
PubMed : 12859949
Length : 36
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve
Target : Pyricularia oryzae, Rhizoctonia solani, Botrytis cinerea ,Beauveria bassiana (weak activity), Staphylococcus aureus (weak activity)
Validated : Experimentally Validated
Comment : Inactive against phytopathogenic bacteria
InterPro : IPR002557 : Chitin-bd_dom.
AMP Family : Abaecin
Signature :
ID Type Pattern / HMM T. Length
CAMPAbaH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IDA
GO:0008061 Molecular Function Chitin binding IDA
GO:0006030 Biological Process Chitin metabolic process IEA
GO:0050832 Biological Process Defense response to fungus IDA
GO:0050829 Biological Process Defense response to Gram-negative bacterium IDA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS