CAMPSQ925
Title : Antifungal protein R
GenInfo Identifier : 417986
Source : Hordeum vulgare [Barley]
Taxonomy : Viridiplantae
NCBI Taxonomy : 4513
UniProt: P33044
PubMed : 1936240
Length : 44
Activity : Antifungal
Target : Trichoderma viridae , Candida albicans
Validated : Experimentally Validated
Pfam : PF00314 : ( Thaumatin family )
InterPro : IPR001938 : Thaumatin.
AMP Family : Thaumatin
Signature :
ID Type Pattern / HMM T. Length
CAMPThaP Pattern A-x-[FI]-[ENT]-[FIV]-x-N-x(2)-[PQST]-x-T-[IV]-W-[AP] Variable
CAMPThaH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
ATITVVNRCSYTVWPGALPGGGVRLDPGQRWALNMPAGTAGAAV