| CAMPSQ945 |
| Title : |
Cp-thionin-2 |
| GenInfo Identifier : |
114152286 |
| Source : |
Vigna unguiculata [Cowpea] |
| Taxonomy : |
Viridiplantae |
| NCBI Taxonomy : |
3917 |
| UniProt: |
P84920 |
| PubMed : |
16824043 |
| Length : |
46 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram+ve, Gram-ve |
| Target : |
Staphylococcus aureus ATTC 25923 ( MIC = 128 mg/ml) , Escherichia coli ATTC 25922 ( MIC = 64 mg/ml) , Pseudomonas syringae ( MIC = 42 mg/ml) |
| Validated : |
Experimentally Validated |
| Comment : |
Inactive against Ralstonia solanacearum, Rhataybacter sp.,Erwinia sp. |
| Pfam : |
PF00304 : ( Gamma-thionin family )
|
| InterPro : |
IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0042742 |
Biological Process |
Defense response to bacterium |
IEA |
| GO:0050832 |
Biological Process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological Process |
Killing of cells of other organism |
IEA |
|
Sequence: |
KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNC |
